PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00313.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 538aa    MW: 62539.9 Da    PI: 6.5517
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00313.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM114.88.7e-36371662128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknr.atksgyWk 84 
                              ppG+rF Ptd el+ +yLk+  ++k+ ++ ++ i++++iy+++P++L +++k+ + +ew+f s+r k +++g++++r   + gyW+
  Rsa1.0_00313.1_g00015.1  37 PPGYRFVPTDAELIYYYLKPFSRDKNKSCPNFpIHHANIYESNPQQLTAEYKKgNLTEWFFISERTKIKRNGTKQKRgDHNGGYWH 122
                              9*************************9998888**************9655551556********************9899***** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              a+  +k++++kk+  vg k+tL +y g++p+g++t+W+m+ey l
  Rsa1.0_00313.1_g00015.1 123 AKAATKTIKAKKQGIVGYKTTLNYYVGKQPNGVRTNWLMKEYWL 166
                              ******************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-4229185IPR003441NAC domain
PROSITE profilePS5100540.30236185IPR003441NAC domain
PfamPF023652.4E-1937165IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MTPQRNKCRE TQQPCPQHDP NMQPSSSSSA SSSLAYPPGY RFVPTDAELI YYYLKPFSRD  60
KNKSCPNFPI HHANIYESNP QQLTAEYKKG NLTEWFFISE RTKIKRNGTK QKRGDHNGGY  120
WHAKAATKTI KAKKQGIVGY KTTLNYYVGK QPNGVRTNWL MKEYWLESSD HNNTVDYAIC  180
KIYLKPTAKG NMEEEDVEDL EEEFVQPSNV EYQQPQPQFR QPELDSHQPQ RHDIAYQEPL  240
QPQPLNTIYH HQSHNTESEF EELHQPQPLN TIHHHHQQQR HGSAYQEPHQ PHPLDSIIPH  300
QSQRHGIANQ EPHQPQPLVT TDHHRPQLHD IAYQEPDQSQ SLDIIVHHQS HQVQLWQATL  360
GSHQTQPHDI AYYEPHQPHP IDTVQNQLPR FWPTPLDSYP PHCHDIQYPQ PQPLDVTEYQ  420
FLYQSGPLTT YENMIGSCTK ENSNGDIKKV DHDALKSHLT PRGIKREAEE EEDEKRKRKK  480
KEGGVEASKE ELEQPINSHQ NSGDGDSFFT GFIDTHLLDI DIESSIDRYR LKKSSDKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-193218513165NO APICAL MERISTEM PROTEIN
1ut4_B6e-193218513165NO APICAL MERISTEM PROTEIN
1ut7_A6e-193218513165NO APICAL MERISTEM PROTEIN
1ut7_B6e-193218513165NO APICAL MERISTEM PROTEIN
3swm_A7e-193218516168NAC domain-containing protein 19
3swm_B7e-193218516168NAC domain-containing protein 19
3swm_C7e-193218516168NAC domain-containing protein 19
3swm_D7e-193218516168NAC domain-containing protein 19
3swp_A7e-193218516168NAC domain-containing protein 19
3swp_B7e-193218516168NAC domain-containing protein 19
3swp_C7e-193218516168NAC domain-containing protein 19
3swp_D7e-193218516168NAC domain-containing protein 19
4dul_A6e-193218513165NAC domain-containing protein 19
4dul_B6e-193218513165NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1474480KRKRKKK
2475479RKRKK
3475481RKRKKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009139340.10.0PREDICTED: protein IWS1 homolog
TrEMBLA0A078E6651e-129A0A078E665_BRANA; BnaC05g07680D protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27931563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56530.13e-55NAC domain containing protein 64